The amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.
نویسندگان
چکیده
The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGMNAW- VAWRNRCKGTDVSVWTRGCRL. This sequence had 9 amino acid substitutions compared with hen egg-white lysozyme. Two of these substitutions, positions 34 and 121, were newly detected in phasianid birds. The protein genealogy of phasianid bird lysozymes showed some discordance with the morphological classification of these birds.
منابع مشابه
Reptile lysozyme: the complete amino acid sequence of soft-shelled turtle lysozyme and its activity.
Soft-shelled turtle egg-white lysozyme was purified and sequenced. Lysozyme was reduced and carboxymethylated to fragment it with trypsin, V8 protease and CNBr. The peptides yielded were purified by RP-HPLC and sequenced. Every trypsin peptide was overlapped by V8 protease peptides and CNBr fragment. The amino acid sequence was compared with other lysozymes. This lysozyme has an extra Gly resid...
متن کاملTurkey egg white lysozyme. Preparation of the crystalline enzyme and investigation of the amino acid sequence.
Crystalline turkey egg white lysozyme has been prepared by a simple procedure consisting of adsorption on carboxymethylcellulose followed by elution with (NH4)&03 solution and crystallization from 5 % NaCl solution. The twice crystallized enzyme gave a single peak when eluted from carboxymethylcellulose, and it migrated as a single band during disc electrophoresis. Separation of the tryptic pep...
متن کاملAmino acid sequence studies on bobwhite quail egg white lysozyme.
To test the immunological prediction that there should be two amino acid sequence differences between the lysozymes of the bobwhite quail and the chicken, the sequences of these two lysozymes have now been compared. Lysozyme purified from bobwhite quail egg white was reduced, carboxymethylated, and digested with trypsin. The resulting 18 peptides were separated and their compositions determined...
متن کاملMitochondrial DNA diversification among the subspecies of the Silver and Kalij Pheasants, Lophura nycthemera and L. leucomelanos , Phasianidae
The taxonomic status of the pheasant superspecies Lophura leucomelanos and Lophura nycthemera has been unclear since 1948. Molecular techniques provided the opportunity to clarify the situation. Using sequences of mitochondrial DNA (800 nucleotides from the D-loop, plus 400 from the cyt b ) from 49 specimens belonging to 10 subspecies (plus two outgroups), we constructed a phylogeny of the subs...
متن کاملChromatography of Pepsin and Chymotrypsin Digests of Egg White Lysozyme on Phosphocellulose.
The present study was initiated as an attempt to evaluate the usefulness of the cellulose ion exchange agents for peptide chromatography. Since these techniques are of immediate application to the determination of amino acid sequence, different groups of peptides from the same protein have been studied with the hope that these might yield sufficient information to permit the elucidation of the ...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
برای دانلود متن کامل این مقاله و بیش از 32 میلیون مقاله دیگر ابتدا ثبت نام کنید
ثبت ناماگر عضو سایت هستید لطفا وارد حساب کاربری خود شوید
ورودعنوان ژورنال:
- Agricultural and biological chemistry
دوره 55 7 شماره
صفحات -
تاریخ انتشار 1991